PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA034185-PA
Common NameOsI_35726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 948aa    MW: 104999 Da    PI: 6.2508
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA034185-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.63e-29594644252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  BGIOSGA034185-PA 594 EKSVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 644
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348583664IPR003035RWP-RK domain
PfamPF020424.3E-26597644IPR003035RWP-RK domain
SuperFamilySSF542771.14E-23841936No hitNo description
Gene3DG3DSA:3.10.20.2407.4E-25847929No hitNo description
SMARTSM006667.1E-26850932IPR000270PB1 domain
PfamPF005641.0E-18850931IPR000270PB1 domain
PROSITE profilePS5174527.157850932IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MDGGGTPDGD PVPDMDMLML SSALDGLDSY TDLVAGSLVA DSIFSALTCF PPSQERLLHV  60
STHVGSSSKQ DDSDVSITEE GNTTRTRSDR AAGLASGEPV AAGIGSVPKP FDGVTLTERM  120
LRALAMLKEA SGGEAILVQV WMPVRNGEQH VLTTSDQPFL LDQKLTGYRE VSRQFTFSAE  180
EGPGLFPGLP GRVFMSGMPE WTSNVMYYHG SEYLRVDYAR RHEVRGSLAM PVFNSSGGSC  240
CAVLEVVMTR EKDNFCLEMV NVSNALQGQS ERQAEFLVVY ITHKHKPPPI IQLPRTSWNL  300
ETGQSIQSQI SPIESVQLST VNAWRHSQSY SRDQKLALME IFDVLQAVCQ AHLLPLALAW  360
IPVCSKRDVL VSIEYGAKFG KRNKEVLCIE ESACYVNDTR VRDFVQVCAE HPLEKGQGVA  420
GNAYLSNNPF FSSDVKDYDM HAYPLVNHAR KFGLHAAVAI RLQSTYTKND DYVLEFFLPV  480
LCKGGEEQQL LLDSISATMR KVCKSLRTVS DAELKEDVTR KLSNENRSGT RCPSPVNLIY  540
SGREIDVSNE TKTNTPLEYQ IEGIDEQLSD TKSTNKLIKC SNASDGEKRR SSTEKSVSLS  600
VLQQYFSGSL KDAAKSIGVC PTTLKRICRQ HGISRWPSRK IKKVNRSLKK IQNVISSVHG  660
VEGVLKYDPS TGCLISSVSP SIEPVLMNVE HKGSDPLPIE SELPHLNFEP DCDAYRREHA  720
GQDVLHKLQN KQNGEINFDM DDGELFRNSH STRTLSGAFC EDMSNGLYVA REMTCVAKTG  780
TRTERLEHKP SSRDSFSAPQ EYRMESETDK SNKNSKQSLP SSSSMTDCST SSGETFKSIK  840
SQSANESNTT VVVKASYKND TIRFKLLPSM KYEQLLEEIA KRLKLSIGLF QLKYKDDEGD  900
WVILASDADL QECLEILDTT RLRILKLQVQ DVVCPIGSSS GSCSMLRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.100840.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329748770.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616880.10.0PREDICTED: protein NLP2-like isoform X1
RefseqXP_015616881.10.0PREDICTED: protein NLP2-like isoform X1
TrEMBLB8BJY50.0B8BJY5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA034185-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein